DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Glipr1l1

DIOPT Version :10

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:211 Identity:42/211 - (19%)
Similarity:71/211 - (33%) Gaps:67/211 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VPDI--PKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSF 119
            ||.|  ||.....|.|.|..|            .:....|..|.|:.||.:||.:|::.......
Mouse    33 VPTITDPKFIDAFLNIHNELR------------RKVQPPAADMNQLFWDQQLAKLAKAWTRECKL 85

  Fly   120 QHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFD-----EHLHI----QDPRGLLQG 175
            .|..|                           :|:.::.:.|     |::::    ..|..::..
Mouse    86 AHNPC---------------------------IKQRYECLEDYDFIGENIYLGRIETQPEDVVIN 123

  Fly   176 FHPIRDY----------VSSHFTIIVSDRVSRVGCGVAVGTNC--RQGSSSNFCHFLTCYFDYDN 228
            ::....|          :..|:|.:|..:..::||.|   :||  .:|.|:..  |:..|....|
Mouse   124 WYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAV---SNCPNLKGFSAGL--FVCNYSPAGN 183

  Fly   229 VNGSYVYKAGKPASSC 244
            ..|...|..|...|.|
Mouse   184 FIGFRPYTRGDSCSMC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 CAP_euk 64..225 CDD:349399 31/181 (17%)
Glipr1l1NP_081294.1 CAP_GLIPR1-like 40..182 CDD:349404 32/185 (17%)

Return to query results.
Submit another query.