DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crisp1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:283 Identity:52/283 - (18%)
Similarity:98/283 - (34%) Gaps:88/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSAVLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDI-PKLR 64
            :.|:|.|.|.:.:.|:.:                     .:||:      ..|:.::.:. .:.:
  Rat     9 LFLAATLTVFVPVVTLRH---------------------LKLDR------ALYNQLITESQTEPQ 46

  Fly    65 TEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELA--------YMARSHASTVS--F 119
            .||:...|.||...:            ..|:.|.::.|.|..|        |..:|.:.::.  .
  Rat    47 EEIVDTHNAFRRNVS------------PPARNMLKMSWSSAAAENARILARYCDKSDSDSLERRL 99

  Fly   120 QHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIR--DY 182
            .:|.|         ||.:.|      .....:...:.:|.::|..:.:      .|..|..  |.
  Rat   100 PNTFC---------GENMHM------ENYPSSWSNVIEIWYNESKYFK------YGEWPSTDDDI 143

  Fly   183 VSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF---CHFLTCYFDYDNVNGSYVYKAGKPASSC 244
            .:.|:|.:|......:||.||   :||:..::.:   ||:  |:........:..||.|.|...|
  Rat   144 ETYHYTQMVWASSYLIGCDVA---SCRRQKAATYLYVCHY--CHEGNSQDTLNMPYKEGPPCQDC 203

  Fly   245 SDWGTTKSKEFANLC-----YNN 262
            .:  ..:.....|.|     |||
  Rat   204 PN--NCEDGLCTNPCLYYDEYNN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 34/175 (19%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 33/173 (19%)
Crisp 200..254 CDD:285731 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.