DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crisp3

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:224 Identity:53/224 - (23%)
Similarity:81/224 - (36%) Gaps:49/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DIPKLRTEILRI---INNFRNQFASGAFRTSENRTFT-QAKRMRQILWDSELAYMARSHASTVSF 119
            |:..|.|..|.:   |.|..||.         .||.: ....:.::.||.:....|:..|:...:
  Rat    29 DLENLSTTKLSVQEEIINKHNQL---------RRTVSPSGSDLLRVEWDHDAYVNAQKWANRCIY 84

  Fly   120 QHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVS 184
            .|:..:......:.||.|.|.      ....:...:.:..:||.|      ..:.||.|.:..|.
  Rat    85 NHSPLQHRTTTLKCGENLFMA------NYPASWSSVIQDWYDESL------DFVFGFGPKKVGVK 137

  Fly   185 -SHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF--CHFLTCYFDYDNVNGSYV------YKAGKP 240
             .|:|.:|.:....|.||||   .|.......|  ||:..        .|:||      |..|:|
  Rat   138 VGHYTQVVWNSTFLVACGVA---ECPDQPLKYFYVCHYCP--------GGNYVGRLYSPYTEGEP 191

  Fly   241 ASS----CSDWGTTKSKEFANLCYNNGNL 265
            ..|    |.|...|.|.|:.:...|.|:|
  Rat   192 CDSCPGNCEDGLCTNSCEYEDNYSNCGDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/167 (22%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 34/158 (22%)
Crisp 192..246 CDD:285731 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.