DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and crispld2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:263 Identity:59/263 - (22%)
Similarity:89/263 - (33%) Gaps:97/263 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSEN 88
            ::||.|.||        |.||                    .||:::.|..|.|           
 Frog    45 HSRTRRAIL--------RTDK--------------------EEIIQLHNKLRGQ----------- 70

  Fly    89 RTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALK 153
             ....|..|..:.||.||...|.:.|....::|   ..|.....:|:.||:...:|:...:    
 Frog    71 -VHPSASNMEYMTWDDELEKSAEAWAEECIWEH---GPTALLMSIGQNLAVHWGRYRQPAY---- 127

  Fly   154 KMFKIMFDEHLHIQDPRGLLQGFHPIRDY-------------------VSSHFTIIVSDRVSRVG 199
                       |:|      ..:..::||                   :.:|:|.||....::||
 Frog   128 -----------HVQ------SWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVG 175

  Fly   200 CGVAVGTNCRQ----GSSSNFCHFLTC-YFDYDNVNGSYVYKAGKPASSC--SDWGTTKSKEFAN 257
            |.|.|   |::    |.......:|.| |....|..|...||.|:|.|.|  |..|..::    |
 Frog   176 CAVNV---CKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQN----N 233

  Fly   258 LCY 260
            |||
 Frog   234 LCY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 37/184 (20%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 37/203 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.