DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and r3hdml

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:204 Identity:49/204 - (24%)
Similarity:83/204 - (40%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RNQFASGAFRTS--------ENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFP 131
            |.:|.||...|:        .::.|..|..|..::||..||..|...||...::|.....   ..
Zfish    57 RRRFISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHF---LQ 118

  Fly   132 RVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIR--DYVSSHFTIIVSDR 194
            .:|:.|:::..:||..:     .:.|..:||.....         :|.|  ..|.:|:|.:|...
Zfish   119 HIGQNLSIISGRYKSII-----DLVKSWYDERHSFS---------YPSRCSGSVCTHYTQMVWAA 169

  Fly   195 VSRVGCGVAVGTNCRQ----GSSSNFCHFLTCYFDYDNVNGSYV----YKAGKPASSC-SDWGTT 250
            .:::||.:   ..|..    ||.......|.|.:   .:.|::|    ||.|:|.|:| |.:|.:
Zfish   170 SNKIGCAI---KKCSDIFVFGSMWKQATLLVCNY---AIKGNWVGEAPYKIGRPCSACPSSYGGS 228

  Fly   251 KSKEFANLC 259
            .:|   |.|
Zfish   229 CNK---NQC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/163 (22%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 32/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.