DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and PI15

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:222 Identity:57/222 - (25%)
Similarity:97/222 - (43%) Gaps:47/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DIPKLR-------TEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHAST 116
            ||||.|       .:::.|: ::.||.        ..:.|..|..|..::||..||..|.:.|:|
Human    52 DIPKARRKRYISQNDMIAIL-DYHNQV--------RGKVFPPAANMEYMVWDENLAKSAEAWAAT 107

  Fly   117 VSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQD----------PRG 171
            ..:.|.. ...:||  :|:.|::...:|:     ::.::.|..:||   ::|          ||.
Human   108 CIWDHGP-SYLLRF--LGQNLSVRTGRYR-----SILQLVKPWYDE---VKDYAFPYPQDCNPRC 161

  Fly   172 LLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCR-QGSSSNFCHFLTC-YFDYDNVNGSYV 234
            .::.|.|    :.:|:|.:|....:|:||.:....|.. .||......:|.| |....|..|...
Human   162 PMRCFGP----MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAP 222

  Fly   235 YKAGKPASSC-SDWGTTKSKEFANLCY 260
            ||.|.|.||| ..:|.:.:.   |||:
Human   223 YKVGVPCSSCPPSYGGSCTD---NLCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 40/179 (22%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.