DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:234 Identity:50/234 - (21%)
Similarity:84/234 - (35%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KIPSLGGTRYHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAY 108
            ::|...|    .::|.:|.:...      .|:|.|.: :...:..:....|..|.|:.||..||.
  Rat    21 RLPKAFG----KVLPRVPTINDP------EFKNGFLN-SHNEARRKVQPPASNMNQLSWDKSLAK 74

  Fly   109 MARSHASTVSFQHTKCRS-----TVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQD 168
            :|:|......|.|..|.|     |..:..:||.:                         :|...|
  Rat    75 LAKSWTRECKFSHNPCTSKRHGCTKDYDYIGENI-------------------------YLGKID 114

  Fly   169 PRG---LLQGFHPIRDY---------VSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLT 221
            .|.   :...::..:||         ...|:|.:|..:..::||.:   :||...:..:...|:.
  Rat   115 ARPEDVVFSWYNETKDYNFDDNTCTKTCGHYTQVVWAKTLKIGCAI---SNCPHLTGYSAGLFVC 176

  Fly   222 CYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFAN-LC 259
            .|....|..||..|..|:|.|.|.:      ||..| ||
  Rat   177 NYVPAGNFQGSKPYIKGEPCSMCGE------KECVNSLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 33/177 (19%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344778
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.