DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and glipr2l

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:175 Identity:39/175 - (22%)
Similarity:63/175 - (36%) Gaps:42/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRF 130
            |.|:..|.:|.:..:...:.|....             ||.:..|.|.|||...:|     :|..
Zfish    12 EALKTHNEYRRKHQAPPLKLSSKLC-------------SEASRYAESLASTRILKH-----SVES 58

  Fly   131 PR--VGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSD 193
            .|  .||.||.  ..|..|..:...:.:..:  ...:...| |...|        :.|||.:|..
Zfish    59 SRGNCGENLAW--ASYDQTGKDVTDRWYNEV--NQYNFNQP-GFSSG--------TGHFTAVVWK 110

  Fly   194 RVSRVGCGVAVGTNCRQGSSSNFCHFLTC-YFDYDNVNGSYVYKA 237
            ...::|.|.||.::   ||:     |:.. ||...|:.....::|
Zfish   111 GSKKLGVGKAVASD---GST-----FVVARYFPAGNITNQGHFQA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/161 (22%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.