DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG8483

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:273 Identity:70/273 - (25%)
Similarity:102/273 - (37%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SAVLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEIL 68
            ||||...:||.:....: .||.                  ||.:.|.|         .:.|:.||
  Fly     5 SAVLLTTIMIISCEVAF-ACNG------------------KIIASGIT---------AEERSIIL 41

  Fly    69 RIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRV 133
            :..|..|...|:|.:.....     |:.||:|:||.|||..|:..|....|:|...|:..|| .:
  Fly    42 QEHNRLRQIVATGRYPGQPG-----AENMREIVWDDELAARAQKWADNCQFRHDPHRTINRF-TM 100

  Fly   134 GECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQD---PRGLLQGFHPIRDY--------VSSHF 187
            |:.||:                  |.....|...|   |..:...|:.::.|        .:.|:
  Fly   101 GQNLAI------------------IWSTAPLDADDGDFPSRIQSWFNEVQKYSFGDAWSPKTGHY 147

  Fly   188 TIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTC-YFDYDNVNGSYVYKAGKPASSCSDWGTTK 251
            :.:|....|.||||.|     ....:|.:.....| |....||.|...|:.|||  |||.:|...
  Fly   148 SQLVWGETSLVGCGYA-----EYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKP--SCSTYGMKP 205

  Fly   252 SKEFANLCYNNGN 264
            |..:..||...|:
  Fly   206 SSRYQGLCAAPGS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 43/172 (25%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 42/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.