DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and scpr-A

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:274 Identity:73/274 - (26%)
Similarity:122/274 - (44%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSAVLPVILM-ISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLR 64
            |..:.||.:||: :..::...:||...|  |:   .:|..|. :|     |........|:.:::
  Fly     1 MAFTKVLQLILLAVVAISSAVDYCALPT--CL---DKHVACN-NK-----GNFSENCPKDVREVK 54

  Fly    65 TE-----ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKC 124
            .|     ||.:.|..||..|.|..     ....:|.||.::.|..||:::|..:..|......||
  Fly    55 IEPHHKLILNLFNELRNNVAGGKI-----EGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC 114

  Fly   125 RSTVRFPRVGECLAMMVPKY-----KHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVS 184
            |||.||...|:..|:.  :|     ::|..|.:|:..:..|.|..: ..|..|......:.:...
  Fly   115 RSTERFAYAGQNNALF--QYSGAETEYTDAEIIKEEIENWFAERSN-ASPEILASFPEELPNKAV 176

  Fly   185 SHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHF-LTCYFDYDNVNGSYVYKAGKPASS-CSD- 246
            :.|||.|:::.:.|||...      :.|...:.|| |||.|...|:.|..||..|:.|:: |.: 
  Fly   177 TKFTIAVAEKNTHVGCAAV------RFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNR 235

  Fly   247 WGTTKSKEFANLCY 260
            :|.  :.::.||||
  Fly   236 YGA--AYDYPNLCY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 46/171 (27%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 45/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440626
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.