DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and scpr-C

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster


Alignment Length:271 Identity:72/271 - (26%)
Similarity:120/271 - (44%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLPVILMISTM--TYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTE- 66
            |:..:||:.|.:  :...:||...|  |:   .:|..|. :|     |........|:.:::.| 
  Fly     2 AIKSLILLTSLLGISLAADYCALPT--CL---DKHIACN-NK-----GNFSENCPKDVREVKIEP 55

  Fly    67 ----ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRST 127
                ||.:.|..||..|.|..     ....:|.||.::.|..||:::|..:..|......|||||
  Fly    56 HHKLILNLFNELRNNVAGGKI-----EGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRST 115

  Fly   128 VRFPRVGECLAMMVPKY-----KHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHF 187
            .||...|:..|:.  :|     ::|..|.:|:..:..|.|..: ..|..|......:.:...:.|
  Fly   116 ERFAYAGQNNAVF--QYSGAETEYTDAEIIKEQIENWFAERSN-ASPEILASFPEELPNKAVTKF 177

  Fly   188 TIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHF-LTCYFDYDNVNGSYVYKAGKPASS-CSD-WGT 249
            ||.|:::.:.|||...      :.|...:.|| |||.|...|:.|..||..|:.|:: |.: :|.
  Fly   178 TIAVAEKNTHVGCAAV------RFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGA 236

  Fly   250 TKSKEFANLCY 260
              :.::.||||
  Fly   237 --AYDYPNLCY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 46/171 (27%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 45/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440647
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.