DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG11977

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:223 Identity:55/223 - (24%)
Similarity:85/223 - (38%) Gaps:57/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRIINNFRNQFASGAFRT 85
            :|||  ...| ..|.:|..|......:..|..:..:  .:...|.:|:|.:||||.:...|.   
  Fly    43 DYCN--ADIC-PANKKHITCGFKFWSTKCGRNHEGV--RMSDYRYDIVRNVNNFRRKLEWGL--- 99

  Fly    86 SENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHT--KCRSTVRFPRVGECLAMMVPKYKHTV 148
               ....:|.:.:.|.||.||:.|| ...|....|||  .|.:|..:..|||....:  |.::| 
  Fly   100 ---GNLPRAVKFKNIKWDDELSVMA-MRVSNQCLQHTFSPCVNTFLYKDVGESSDFV--KVQNT- 157

  Fly   149 HEALKKMFKI-----MFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRV-----------SR 197
                .|.|.:     |:.|:..:..|           .||::...|...||:           .:
  Fly   158 ----SKGFNVISFLNMWFEYHKMMKP-----------SYVNNFPNIAPQDRLIIFANLIYEKNKK 207

  Fly   198 VGCGVAVGTNCRQGSSSNFCHFLTCYFD 225
            :|||:.     :.|..    .||||.||
  Fly   208 MGCGMV-----KSGQG----RFLTCLFD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 45/178 (25%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 45/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.