DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG42564

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:261 Identity:62/261 - (23%)
Similarity:99/261 - (37%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NYCN-NRTHR------CILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRIINNFRNQF 78
            :||: :..|:      |......|..|.||.          .::...||:...:||..|..|:..
  Fly    54 DYCDPSLCHKELKHVACNASIELHDKCSLDA----------ELIVISPKVERFLLRRFNELRDSV 108

  Fly    79 ASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAM---- 139
            |.|.|     ...:.|.||..:.|:.||||:|..:......:|.:||:|......|:.:..    
  Fly   109 AKGGF-----NGLSPASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGIK 168

  Fly   140 -MVPKYKHTVHEAL---------KKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDR 194
             .:|:.:..:.:.:         ..|..||.......|.|:              .:|..||.:.
  Fly   169 GKLPELEDILRDIIGVWLREKSRTSMVNIMKYVEQESQSPK--------------YNFLQIVLEN 219

  Fly   195 VSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPAS-SCSDWGTTKSKEFANL 258
            ...|||  |:....|.|....   |..|.:.:..|.||.||:.||.|: ||.   |..:.::|:|
  Fly   220 AESVGC--AIVQQSRHGWIQT---FFACNYGHAPVVGSPVYEPGKKAAESCK---TGANPKYAHL 276

  Fly   259 C 259
            |
  Fly   277 C 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 38/174 (22%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 38/173 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440633
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.