DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and glipr1b

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:272 Identity:55/272 - (20%)
Similarity:93/272 - (34%) Gaps:87/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDI--PKLRTEILRII 71
            ::|.||.:.||         .|.:|                     |::|.|  |:.....::..
Zfish     7 LLLRISVVLYG---------SCSVL---------------------ALLPGITEPEFIRRCVKAH 41

  Fly    72 NNFRNQF---ASGAFRTSENRTFTQAKRMRQIL----WDSELAYMARSHASTVSFQHTKCRSTVR 129
            |..|.:.   |:||           ...:||:.    ||.|||..||..|......|........
Zfish    42 NTHRARVSPPAAGA-----------RSMVRQVFGMQSWDKELAKGARDRARHCKGSHYPSLGHFG 95

  Fly   130 FPR---VGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRD----YVSSHF 187
            .|.   :||.:.:..|....:|..|:.:..|                :|.:.:::    .:..|:
Zfish    96 HPLFGWMGENIWLGSPFSAFSVENAVHRWSK----------------EGAYSVKNNNCSRLCGHY 144

  Fly   188 TIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH-----FLTCYFDYDNVNGSYVYKAGKPASSCSDW 247
            ..::.....::||.|.|   |.:|..:...|     |:..|.|...|:|...|.    |..||..
Zfish   145 AQLMWSTSFKMGCAVNV---CSKGIENFSTHPESTIFVCNYGDTGQVHGVTPYM----AMGCSGC 202

  Fly   248 GTTKSKEFANLC 259
            |:...::  |:|
Zfish   203 GSEICRD--NVC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 34/179 (19%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 34/182 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.