DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and crispld1b

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:224 Identity:52/224 - (23%)
Similarity:77/224 - (34%) Gaps:73/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFP 131
            ||.:.|..|.|            .:..|..|..::||:||...|...|.|..::|....   ...
Zfish    66 ILDLHNKLRGQ------------VYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSH---LLT 115

  Fly   132 RVGECLAMMVPKYKH-------TVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY-----VS 184
            |:|:.|.      .|       |.|      .:..:||......|  ..|..:|...|     |.
Zfish   116 RIGQNLG------AHWGRDRPPTFH------VQAWYDEVRDFSYP--YPQECNPHCPYRCSGPVC 166

  Fly   185 SHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH-------------FLTC-YFDYDNVNGSYVY 235
            :|:|.:|....:::||.:            |.|:             :|.| |....|..|...|
Zfish   167 THYTQLVWATSNKIGCAI------------NVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPY 219

  Fly   236 KAGKPASSC--SDWGTTKSKEFANLCYNN 262
            |.|.|.|:|  |..|..::    ||||.:
Zfish   220 KHGTPCSACPPSYGGGCRN----NLCYKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 38/183 (21%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 37/182 (20%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585731
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.