DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG34049

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:168 Identity:38/168 - (22%)
Similarity:60/168 - (35%) Gaps:46/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IPKLRTE-----ILRIINNFRNQFASGAFRTSENR-TFTQAKRMRQILWDSELAYMARSHASTVS 118
            ||.:|.:     :||..|.:|....:...:..|.. ::.|.       |...||.:.:       
  Fly   137 IPIIRRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQE-------WADHLADLNK------- 187

  Fly   119 FQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMF--KIMFDEHLHIQDPRGLLQGFHPIRD 181
                  ..|...|..||.: |.|.:.|.:|.:.||..:  |..:|.         |..||    :
  Fly   188 ------LETRPNPLYGENI-MRVRRSKFSVDQILKLWYQEKYNYDY---------LKPGF----N 232

  Fly   182 YVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHF 219
            ..:.|||.:|......:|.|||    |...|....|::
  Fly   233 LYTGHFTQLVWRESEFLGVGVA----CDVSSIWIVCNY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/164 (22%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.