DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Glipr2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_081726.1 Gene:Glipr2 / 384009 MGIID:1917770 Length:154 Species:Mus musculus


Alignment Length:182 Identity:38/182 - (20%)
Similarity:67/182 - (36%) Gaps:42/182 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLRTEILRIINNFRNQFASGAFRTSE--NRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKC 124
            :...|:|:..|.:|.|......:..:  ||   :|::..:.|            |||...:|:..
Mouse     8 QFNNEVLKAHNEYRAQHGVPPLKLCKKLNR---EAQQYSEAL------------ASTRILKHSPE 57

  Fly   125 RSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTI 189
            .|.   .:.||.||.  ..|..|..:...:.:..:  :..:.|.| |...|        :.|||.
Mouse    58 SSR---GQCGENLAW--ASYDQTGKDVADRWYSEI--KSYNFQQP-GFTSG--------TGHFTA 106

  Fly   190 IVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTC-YFDYDNVNGSYVYKAGKP 240
            :|.....::|.|.|        |:|:...|:.. ||...|:.....::...|
Mouse   107 MVWKNTKKIGVGKA--------SASDGSSFVVARYFPAGNIVNQGFFEENVP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 35/163 (21%)
Glipr2NP_081726.1 CAP_GAPR1-like 8..139 CDD:349401 36/169 (21%)
Interaction with CAV1. /evidence=ECO:0000250 91..98 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.