DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG3640

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:262 Identity:72/262 - (27%)
Similarity:110/262 - (41%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRII 71
            |.::.:.|...|.::||  :.|.| ..:|.|..|..:....|...|...::|...:|:..|:..:
  Fly    11 LVIVTLNSFPAYSWDYC--QEHWC-PRSTDHVACNNNGTFGLDCGREARLIPLSNQLQAFIVHQV 72

  Fly    72 NNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGEC 136
            |.:|||.|||..     ..|..|:||..:.||.|||.:|...|...|.....||:|.||..||:.
  Fly    73 NFYRNQVASGGL-----SAFGPARRMASVRWDPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQL 132

  Fly   137 LAMMV-PKYKHTVHEALKKMFKIMFDEH------LHIQDPRGLLQGFHPIRDYVSSHFTIIVSDR 194
            ...:: ...||:..|.|:......|.::      |...||...:..|..:....|:|        
  Fly   133 TGHVIFSAGKHSDLELLRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTH-------- 189

  Fly   195 VSRVGCGVAVGTNCRQGSSSNFCH--FLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFAN 257
               :||||     .|| .|....|  |:.|.|...|:....||:.|..|:.|.   :.::..:.|
  Fly   190 ---MGCGV-----LRQ-RSHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCR---SGRNPRYPN 242

  Fly   258 LC 259
            ||
  Fly   243 LC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 48/169 (28%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 48/169 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440675
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.