DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG17974

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:276 Identity:71/276 - (25%)
Similarity:113/276 - (40%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSAVLPVILMISTMTYGYNYC------NNRTH-RCILLNTQHFMCRLDKIPSLGGTRYHAIVP 58
            :|..|:..:|..: .:...|::|      |...| .|......|..|:.|           |:..
  Fly     5 LICLAIFQLIFQL-ILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPD-----------AVQV 57

  Fly    59 DIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTK 123
            |:.:.:.:.|...|..||..|.|     :...:..|.||..::||.||.|::..:..|....|..
  Fly    58 DVSRHKADFLHAHNKRRNFLALG-----KVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDD 117

  Fly   124 CRSTVRFPRVGECL-AMMVPKYKH-TVHEALKKMFKIMFDEHLHIQDPRGLLQGFH--PI-RDYV 183
            |.:|.|:...|:.| |:..|:..| .|...:::...:.|:|...|..  ..:..|.  || .|| 
  Fly   118 CHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDS--SFIDSFKVTPIFEDY- 179

  Fly   184 SSHFTIIVSDRVSRVGCGVAVGTNCRQGSSS----NF-CHFLTCYFDYDNVNGSYVYKAGKPASS 243
             .||..:..|:...|||.:...|  |....|    || |::.:.|     ..|:.||:.|:.||.
  Fly   180 -GHFAELSVDKNFAVGCSIMRFT--RPDYPSVYIYNFICNYASLY-----ALGAPVYETGRAASR 236

  Fly   244 CSDWGTTKSKEFANLC 259
            |:   |.||..:..||
  Fly   237 CT---TGKSHFYPGLC 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 46/170 (27%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 45/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440668
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.