DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:198 Identity:41/198 - (20%)
Similarity:67/198 - (33%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVR-----FPR 132
            |..|:.....|....|        :|.:.||..|:..||:......|:.......|.     |..
  Rat    58 NLHNELRGTVFPPGVN--------LRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESHPVFTD 114

  Fly   133 VGECLAMMVPKYKHTVHEAL------KKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIV 191
            :||.: .:.|:...|...|:      :|.:..:.|..:..:|               .||:..:|
  Rat   115 IGENM-WVGPEKDFTATNAIRSWHEERKSYNYVNDTCIEDED---------------CSHYIQLV 163

  Fly   192 SDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFA 256
            .|...:|||.|   |.|.:..:..:.....|.:..........|:||:..|.|    |.:.|...
  Rat   164 WDHSYKVGCAV---TPCAKVGAITYAALFICNYAPGGTLTRRPYQAGQFCSRC----TNEEKCID 221

  Fly   257 NLC 259
            .||
  Rat   222 FLC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 32/162 (20%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 32/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.