DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and R3hdml

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:192 Identity:50/192 - (26%)
Similarity:82/192 - (42%) Gaps:39/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKI 158
            |..|..::||.:||..|.:.|:...:.|...:.|   ..||:.|::...:|:..|     .:.|.
  Rat    81 ASNMEYMVWDEQLARAAEAWATQCIWAHGPSQLT---KYVGQNLSVHSGRYRSVV-----DLVKS 137

  Fly   159 MFDEHLHIQDPR---------GLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCR-QGSS 213
            ..:|..|...|.         .|..|  |    |.||:|.:|....||:||.:...::.. .||:
  Rat   138 WSEEKRHYSFPAPKDCTPHCPWLCSG--P----VCSHYTQMVWASSSRLGCAIHTCSSINVWGST 196

  Fly   214 SNFCHFLTCYFDYDNVNGSYV----YKAGKPASSC--SDWGTTKSKEFANLCYN--NGNLIP 267
            .....:|.|.:   .:.|:::    ||.|||.|:|  |..|...|    |:|::  ..|.:|
  Rat   197 WQQAVYLVCNY---AIKGNWIGEAPYKTGKPCSACPPSYQGNCNS----NMCFSGLKSNRLP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 35/140 (25%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 35/139 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344652
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.