DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crisp2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:217 Identity:49/217 - (22%)
Similarity:80/217 - (36%) Gaps:41/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PDIPKLRT-------EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHAS 115
            ||...|.|       ||:...|..|.|.:            .....:.::.|:.:.|..|:..|:
  Rat    25 PDFATLTTNQIQVQREIIAKHNELRRQVS------------PPGSNILKMEWNVQAAANAQKWAN 77

  Fly   116 TVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIR 180
            ....:|:.........:.||.|      |..|...:.:.:.:..::|:      ...:.|.....
  Rat    78 NCILEHSSTEDRKINIKCGENL------YMSTDPTSWRTVIQSWYEEN------ENFVFGVGAKP 130

  Fly   181 DYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF--CHFLTCYFDYDNVNGSYVYKAGKPASS 243
            :....|:|.:|.....:||||||...|  |.:...|  ||:  |....:.:..|..|..|.|.:|
  Rat   131 NSAVGHYTQLVWYSSFKVGCGVAYCPN--QDTLKYFYVCHY--CPMGNNVMKKSTPYHQGTPCAS 191

  Fly   244 C---SDWG-TTKSKEFANLCYN 261
            |   .|.| .|.|.:|.:|..|
  Rat   192 CPNNCDNGLCTNSCDFEDLLSN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 33/169 (20%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 32/163 (20%)
Crisp 189..243 CDD:400739 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344757
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.