DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Clec18a

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:228 Identity:47/228 - (20%)
Similarity:77/228 - (33%) Gaps:67/228 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SLGGTRYHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMAR 111
            ||.|..:..:.|..|| :...|:.::...:.....|.....:|....|..|:::.|...||.:|.
Mouse    99 SLLGITWTEVQPPQPK-QDPTLQALSRKESFLILTAHNRLRSRVHPPAANMQRMDWSESLAQLAE 162

  Fly   112 SHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYK----HTVHEA----LKKMFKIMFDEHLHIQD 168
            :.|:.                   |:..:.|...    |..|..    |..|....|.|.:::..
Mouse   163 ARAAL-------------------CVTSVTPNLASTPGHNSHVGWNVQLMPMGSASFVEVVNLWF 208

  Fly   169 PRGLLQGFHP----IRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYD-- 227
            ..| ||..|.    ..:...:|:|.:|....|::|||       ||          .|:.|.:  
Mouse   209 AEG-LQYRHGDAECAHNATCAHYTQLVWATSSQLGCG-------RQ----------PCFVDQEAM 255

  Fly   228 -------------NVNGSYV--YKAGKPASSCS 245
                         ::||..|  ||.|...|.|:
Mouse   256 EAFVCAYSPGGNWDINGKTVAPYKKGTWCSLCT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 32/172 (19%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 32/170 (19%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.