DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG4270

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:90 Identity:19/90 - (21%)
Similarity:31/90 - (34%) Gaps:34/90 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 TVHEALKKMFKIMFDEHL-------HIQDPRG----LLQG-------------FHPIRDY----- 182
            |::.||.|:.: .:..||       |..:|:.    .|.|             :..|..|     
  Fly    52 TINAALNKLAQ-EWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKA 115

  Fly   183 ----VSSHFTIIVSDRVSRVGCGVA 203
                .:.|||.::......:|.|||
  Fly   116 QFVPTAGHFTQLIWKSSVEMGSGVA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 19/90 (21%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
54.940

Return to query results.
Submit another query.