DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG31296

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001262608.1 Gene:CG31296 / 318668 FlyBaseID:FBgn0051296 Length:280 Species:Drosophila melanogaster


Alignment Length:285 Identity:62/285 - (21%)
Similarity:102/285 - (35%) Gaps:72/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILMISTMTYGYNYCNNRTHRCIL--LNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRT------- 65
            :.:::.:.:|   |:.....|.|  ..|.:..|.       ..:::..:.|  |..||       
  Fly     9 VALLNFIPFG---CSKLVDFCQLPYCGTNNLACN-------NPSKFSVMCP--PNARTLSMSTYR 61

  Fly    66 -EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVR 129
             .:|...|.|||..|||    .:......|.||.::.:..||..:||....|.| .|..|.::..
  Fly    62 NLLLIAFNEFRNYTASG----KQKYLKAAAARMSRLSYSMELEDLARLAVITCS-THKFCLNSQE 121

  Fly   130 FPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVS---------- 184
            |..||..:...........:|.|:.|.:|              :|.:....|||:          
  Fly   122 FYYVGTNIGSTHYLGNLNDYEDLELMLRI--------------IQHWTRYADYVNIKMGVYMPTT 172

  Fly   185 ------SHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAG-KPAS 242
                  :...::::||.:.|||.....|   ..|..||. || |.|..|......:|:.. :|.:
  Fly   173 LGKSGIAKALLLMADRNTHVGCSAMRFT---VHSVHNFV-FL-CAFSTDLFVERPIYRMSMRPGA 232

  Fly   243 SCSDWGTTKSKEFANLC-----YNN 262
            :|.....|    ::.||     |.|
  Fly   233 ACKRLDPT----YSALCAVGENYEN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 44/184 (24%)
CG31296NP_001262608.1 SCP_euk 61..214 CDD:240180 42/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.