DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG31286

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:234 Identity:44/234 - (18%)
Similarity:74/234 - (31%) Gaps:78/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSAVLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRT 65
            |:|...|.::.:::...:..|:..|..:..|:|  :....|.|:         |.    :|||  
  Fly     1 MLLIRSLVIVFLVAISEFDRNFAINHDNAGIVL--REINKRRDR---------HG----VPKL-- 48

  Fly    66 EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWD-SELAYMARSHASTVSFQHTKCRSTVR 129
                               |.:|   ..:|..:...|. |:.|.:..|..:...:..:.||..|:
  Fly    49 -------------------TLDN---VLSKGCQSYAWKLSKSATLNYSDPTNKDYTESICRFEVK 91

  Fly   130 FPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDR 194
            ...:..|:.......|              ||    |.||:             :..||.::...
  Fly    92 RGALSRCVKNWYNGRK--------------FD----ILDPK-------------AKDFTAMIWRS 125

  Fly   195 VSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSY 233
            ...:|.|.| ..|..||.      |:..|....||.|.|
  Fly   126 SVSLGYGDA-NINALQGV------FVVRYTPPGNVKGLY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 27/161 (17%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 35/202 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.