DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG32679

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_727412.2 Gene:CG32679 / 318150 FlyBaseID:FBgn0052679 Length:254 Species:Drosophila melanogaster


Alignment Length:266 Identity:72/266 - (27%)
Similarity:120/266 - (45%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCR-LDKIPSLGGTRYHAIVPDIPKLRTEILR 69
            :|.::|:|.|.|:..|||:..    :..:.:|..|: ..:..|.....:..:...||.    ||:
  Fly    10 LLYLVLIIFTFTFAQNYCDPE----LCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPL----ILQ 66

  Fly    70 IINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVG 134
            :.|..||..|.|..     ..|..|.:|..:.||:.||.:|..:|......|.:||:|..:...|
  Fly    67 LHNERRNLIAGGGV-----SGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTNTYRYAG 126

  Fly   135 ECLAMMVPKYKHTVHEA--LKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY------VSSHFTIIV 191
            :.|:::   :..:|..|  |::.....|||:      |....|  .:.||      ...|||.:|
  Fly   127 QNLSIL---FTRSVDVAVFLRQRIAAWFDEN------RDATSG--DMEDYQMRGGPAIGHFTTMV 180

  Fly   192 SDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFA 256
            ::|.:||||.:|..|:.....::    .|.|.:...||..:.||:||..||.|:   |.::..:.
  Fly   181 NERNNRVGCAIARFTDANNVQAT----LLACNYAVTNVVNNPVYRAGTAASECT---TGRNSNYP 238

  Fly   257 NLCYNN 262
            |||..|
  Fly   239 NLCSPN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 45/168 (27%)
CG32679NP_727412.2 SCP_euk 63..210 CDD:240180 45/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440619
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
76.850

Return to query results.
Submit another query.