DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crispld1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:224 Identity:60/224 - (26%)
Similarity:83/224 - (37%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFP 131
            ||.:.|..|:|            .:..|..|..:.||.||...|.|.|.|..::|   ..|...|
  Rat    65 ILDLHNKLRSQ------------VYPAASNMEYMTWDVELERSAESWAETCLWEH---GPTSLLP 114

  Fly   132 RVGECLAMMVPKYK-HTVHEALKKMFKIMFDE-------HLHIQDPRGLLQGFHPIR--DYVSSH 186
            .:|:.|.....:|: .|.|      .:..:||       :.|..||      :.|.|  ..|.:|
  Rat   115 SIGQNLGAHWGRYRPPTFH------VQAWYDEVRDFSYPYEHECDP------YCPFRCSGPVCTH 167

  Fly   187 FTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH-------------FLTC-YFDYDNVNGSYVYKA 237
            :|.:|....||:||.:            |.||             :|.| |....|..|...||.
  Rat   168 YTQVVWATSSRIGCAI------------NLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKH 220

  Fly   238 GKPASSC--SDWGTTKSKEFANLCYNNGN 264
            |||.|:|  |..|..:.    ||||..|:
  Rat   221 GKPCSACPPSFGGGCRE----NLCYKEGS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 44/181 (24%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 43/180 (24%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.