DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Pi15

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:284 Identity:68/284 - (23%)
Similarity:120/284 - (42%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSAVLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVP----DIP 61
            |::.:.:.:::::|.:      |..||  .:|||........:....:..|   ..||    |||
  Rat     1 MVMISAVNLVILLSLL------CEART--IVLLNFTDSSLPANNFSDIEAT---LSVPVLSVDIP 54

  Fly    62 KLR-------TEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSF 119
            |.|       .:::.|: ::.||.        ..:.|..|..|..::||..||..|.:.|:|..:
  Rat    55 KARRKRYISQNDMIAIL-DYHNQV--------RGKVFPPAANMEYMVWDENLAKSAEAWAATCIW 110

  Fly   120 QHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQD----------PRGLLQ 174
            .|.. ...:||  :|:.|::...:|:     ::.::.|..:||   ::|          ||..::
  Rat   111 DHGP-SYLLRF--LGQNLSVRTGRYR-----SILQLVKPWYDE---VKDYAFPYPQDCNPRCPMR 164

  Fly   175 GFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCR-QGSSSNFCHFLTC-YFDYDNVNGSYVYKA 237
            .|.|    :.:|:|.:|....:|:||.:....|.. .||......:|.| |....|..|...||.
  Rat   165 CFGP----MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKV 225

  Fly   238 GKPASSC-SDWGTTKSKEFANLCY 260
            |.|.||| ..:|...:.   |||:
  Rat   226 GVPCSSCPPSYGGACTD---NLCF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 40/179 (22%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344673
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.