DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Glipr1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:235 Identity:51/235 - (21%)
Similarity:83/235 - (35%) Gaps:71/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SLGGTRYHAIVPDIPKLRT-----EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSEL 106
            |..|..|.|  ..:||:..     |.:.:.|:||            ::.:..|..|..:.||.:|
  Rat    14 SASGFSYTA--STLPKITNEDFIEECVEVHNHFR------------SKAYPPAGNMLYMSWDPKL 64

  Fly   107 AYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPR- 170
            |.:|::.|.:..|||.                   |:....:|.....:.:.::...|.:...| 
  Rat    65 AQIAKAWAQSCVFQHN-------------------PQLHSRIHPNFTGLGENIWLGSLSLFSVRA 110

  Fly   171 GLLQGFHPIRDY---------VSSHFTIIVSDRVSRVGCGVAV---GTN--CRQGSSSNFCHFLT 221
            .:|..|...:.|         |..|:|.||.....::||.|.:   |.|  |..|.:.|:     
  Rat   111 AILAWFEESQYYDFSTGKCKKVCGHYTQIVWADSYKIGCAVQLCPRGANFICNYGPAGNY----- 170

  Fly   222 CYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFANLCYN 261
                     .::.||.|...|:|    ....|...|||.|
  Rat   171 ---------PTWPYKQGATCSAC----PKDDKCLNNLCTN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 35/180 (19%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 34/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344715
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.