DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Pi16

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:228 Identity:59/228 - (25%)
Similarity:81/228 - (35%) Gaps:84/228 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IVPDIPKLRTEILRIINNFRNQFASG---AFRTSENRTFTQ------------AKRMRQILWDSE 105
            ::|.:|.|...:|.::.      |:|   |....|.:|..:            |..|.|:.||.|
  Rat    10 MLPQLPLLLLLLLLLLT------ATGPATALTEDEKQTMVELHNHYRAQVSPPASDMLQMRWDDE 68

  Fly   106 LAYMARSHASTVSFQHTKCRSTVRFPRVGECL------AMMVPKYKHTVHEALKKMFKIMFDEHL 164
            ||..|:::|....:.|.|.|.     |.||.|      .|.||......||           ||.
  Rat    69 LAAFAKAYAQKCVWGHNKERG-----RRGENLFAITDEGMDVPLAVGNWHE-----------EHE 117

  Fly   165 HIQ------DPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFC------ 217
            :..      || |.:.|          |:|.:|..:..|:|||            |:||      
  Rat   118 YYNLSTATCDP-GQMCG----------HYTQVVWSKTERIGCG------------SHFCETLQGV 159

  Fly   218 -----HFLTC-YFDYDNVNGSYVYKAGKPASSC 244
                 |.|.| |....||.|...|:.|.|.|.|
  Rat   160 EEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 48/199 (24%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 42/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.