DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and F09B9.5

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:172 Identity:34/172 - (19%)
Similarity:60/172 - (34%) Gaps:48/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ELAYMARSHASTVSFQ-HTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQ- 167
            ||:.||:..|..::.| |.   |......:||.:....|...      .:.:.:..:.||...: 
 Worm    35 ELSEMAQQWADKLAKQAHI---SFSELSGIGENITFFPPDID------AESVVEHWYQEHEKYEY 90

  Fly   168 DPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAV----------GTNCRQGSSSNFCHFLTC 222
            :..|...|        :::||.::......:|.|.|.          .|:|..||   .|..:|.
 Worm    91 ETPGWQTG--------TNYFTQVIWRSTKEIGVGCAYVRKSHENDEDNTSCSNGS---VCKSMTS 144

  Fly   223 YFDYDNVNGSYVYKAGK-------PASSCSDWGTTKSKEFAN 257
            .    :.||....:..|       ||.:     ..:|.:||:
 Worm   145 L----SSNGKLAAEGDKVIVAFYRPAGN-----NNRSGQFAS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 26/131 (20%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 31/156 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.