DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:250 Identity:55/250 - (22%)
Similarity:83/250 - (33%) Gaps:82/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQA 94
            |::..|.      .||||:  |..|.|        ...:...|.:|            .:....|
Human   101 CLVATTS------SKIPSI--TDPHFI--------DNCIEAHNEWR------------GKVNPPA 137

  Fly    95 KRMRQILWDSELAYMARSHASTVSFQHTKC-----RSTVRFPRVGECLAM-----MVPKYKHTVH 149
            ..|:.::||..||.||::.|:...|:|..|     :....|..|||.:.:     ..|::..|..
Human   138 ADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAW 202

  Fly   150 EALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTN------- 207
            ....:.:.  ||.   :...|            |..|:|.:|......|||.||:..|       
Human   203 YNETQFYD--FDS---LSCSR------------VCGHYTQLVWANSFYVGCAVAMCPNLGGASTA 250

  Fly   208 ---CRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFANLC 259
               |..|.:.||.:...             |..|:..|.||    .:.|...|||
Human   251 IFVCNYGPAGNFANMPP-------------YVRGESCSLCS----KEEKCVKNLC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 37/180 (21%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151304
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.