DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crisp2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:214 Identity:51/214 - (23%)
Similarity:82/214 - (38%) Gaps:35/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PDIPKLRT---EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSF 119
            ||...|.|   ::.|.|.|..|:     .|.|.|.|.:...:|.   |..:....|:..|:....
Mouse    25 PDFTSLLTNQLQVQREIVNKHNE-----LRRSVNPTGSDILKME---WSIQATTNAQKWANKCIL 81

  Fly   120 QHTKCRSTVRFPRVGECLAMMV-PKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYV 183
            :|:.........|.||.|.|.. |....||.::       .::|:      ...:.|.....:..
Mouse    82 EHSSKDDRKINIRCGENLYMSTDPTLWSTVIQS-------WYNEN------EDFVYGVGAKPNSA 133

  Fly   184 SSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF--CHFLTCYFDYDNVNGSYVYKAGKPASS--- 243
            ..|:|.:|.....::|||:|...|  |.:...|  ||:  |....:.:..|..|:.|.|.:|   
Mouse   134 VGHYTQLVWYSSFKIGCGIAYCPN--QDNLKYFYVCHY--CPMGNNVMKKSTPYQQGTPCASCPN 194

  Fly   244 -CSDWGTTKSKEFANLCYN 261
             |.:...|.|.:|.:|..|
Mouse   195 NCENGLCTNSCDFEDLLSN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 37/166 (22%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 35/159 (22%)
Crisp 189..243 CDD:285731 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.