DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and F58E2.5

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:285 Identity:63/285 - (22%)
Similarity:99/285 - (34%) Gaps:129/285 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRI 70
            :||.:|:::.:|:            :.||....:...|                       ||..
 Worm    17 LLPYLLLMNCITF------------LFLNLASAIAHKD-----------------------ILNA 46

  Fly    71 INNFRNQFASGAFRTSENRTFTQ-------------AKRMRQILWDSELAYMARSHASTVSFQHT 122
            .||.|::.|:|        |||.             |..|.::.|:..||.:|:::         
 Worm    47 YNNLRSEIANG--------TFTMKLQFPDITIPLAPAAGMLKLKWNCRLAALAQAY--------- 94

  Fly   123 KCRSTVRFPRVGECLAMMVPKYKH-TVHEALKKMFKIMF---DEHL--HIQDPRGLLQGFHPI-- 179
                      |..|     |.|:. .||   |..|.:.:   |.:|  ||:||  :|..|..:  
 Worm    95 ----------VDSC-----PSYQDLRVH---KPKFPVTYSFLDANLQEHIKDP--VLYRFKILEM 139

  Fly   180 ---RDYVSSH-FTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFD---YDN----VNG-- 231
               |.|::.. |..::|.:  .:||..   .||    |.|.  ...||:.   |::    |||  
 Worm   140 DFRRGYINDDWFKKLISSK--SIGCAF---NNC----SENV--LFVCYYKEQIYEDFKFPVNGGA 193

  Fly   232 ----------SYV--YKAGKPASSC 244
                      .||  ||.||..|:|
 Worm   194 EPGRFIKELDDYVPRYKEGKACSAC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 44/185 (24%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 44/207 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.