DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and scl-24

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_507429.1 Gene:scl-24 / 184188 WormBaseID:WBGene00008575 Length:212 Species:Caenorhabditis elegans


Alignment Length:209 Identity:38/209 - (18%)
Similarity:79/209 - (37%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCR--STVR 129
            |:.|.|..||..:.|.:   |..:.:::..|:.:.|:..|       .:.|..:...|.  ....
 Worm    34 IVFIHNKLRNAASHGLW---ERYSISKSSNMQLLSWNESL-------VAEVENEKYYCEPADNKN 88

  Fly   130 FP-RVGECLAMMVPKYKHTVH-----EALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFT 188
            .| ::|:.:      |::.|:     :.:..|..|..|.|..::......:  :.:|..:.|   
 Worm    89 LPIKLGDNI------YQYDVNTYDDIDGVGAMGSINKDTHNALKSEEKATK--NRLRQMLYS--- 142

  Fly   189 IIVSDRVSRVGCGVAVGTNCRQGSSSNF---CHFLTCYFD--YDNVNGSYVYKAGKPASSCSDWG 248
                 :...:||   :..:|.:..|...   ...:.|.:.  .:|:: ..::..|:|.|:|.. |
 Worm   143 -----KSKSIGC---IYESCDKIDSKGINYNTRLVICKYSPPLENID-EQLFDKGEPCSNCPS-G 197

  Fly   249 T---TKSKEFANLC 259
            |   |...|...||
 Worm   198 TSCGTDPNEMMKLC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 27/168 (16%)
scl-24NP_507429.1 CAP_euk 31..174 CDD:349399 27/168 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.