DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and scl-23

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_499859.3 Gene:scl-23 / 182028 WormBaseID:WBGene00015246 Length:330 Species:Caenorhabditis elegans


Alignment Length:273 Identity:53/273 - (19%)
Similarity:92/273 - (33%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VILMISTMTYGYNYCNNRTHR----CILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILR 69
            |.:.::.:|..||.....|.|    .::.......|||: :|:              :|:..||.
 Worm    78 VFIAVTVITLSYNILAASTPRPSRFSVITKMAPAYCRLN-LPA--------------RLQNLILD 127

  Fly    70 IINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVG 134
            ..|..|:|.|.|.:...:: ....|..|.::.||.||...|:..|...:.|              
 Worm   128 KHNEIRSQVALGQYAVDDD-YLPPADNMVKLDWDCELELEAQQRAQQCNLQ-------------- 177

  Fly   135 ECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGL------LQGFHPIRDYVS--------- 184
                      |......:....::..:...:.:...||      |:|...:.|.::         
 Worm   178 ----------KENSGRQMNGWDEVRGENAFYFRTTDGLDVSGAVLKGIQRMGDEIAIAGIKNLKL 232

  Fly   185 -------SHFTIIVSDRVSRVGCGVAVGTNCRQGS-SSNFCHFLTC-YFDYDNV----NGSYVYK 236
                   .|.|.|:.....::||.|......:.|| .....:...| |:...||    ..:.:|.
 Worm   233 SRYDSRIGHATQILWKETRKLGCAVQECPARQDGSLDGQKYNVAVCKYYPTGNVFKSSTPTSIYS 297

  Fly   237 AGKPASSCSDWGT 249
            .|..||:||: ||
 Worm   298 VGDVASACSE-GT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 32/184 (17%)
scl-23NP_499859.3 CAP_euk 122..281 CDD:349399 31/183 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157355
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.