DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and vap-1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:203 Identity:47/203 - (23%)
Similarity:86/203 - (42%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRS 126
            ||||.:.:.:.  .:..|:|||.       ..||:|.::.:...:...||:.|....:||:   :
 Worm   245 KLRTSLAKGLE--ADGIAAGAFA-------PMAKQMPKLKYSCTVEANARTWAKGCLYQHS---T 297

  Fly   127 TVRFPRVGECLAMM----VPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHF 187
            :.:.|.:||.|.|:    :||.: |..::.|..:..:.|  ..:.....|.|.   :.|....|:
 Worm   298 SAQRPGLGENLYMISINNMPKIQ-TAEDSSKAWWSELKD--FGVGSDNILTQA---VFDRGVGHY 356

  Fly   188 TIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKS 252
            |.:..:..:.:||.|   .||     ..|.:.:..|....|.....:|..|.|.::.:|...|::
 Worm   357 TQMAWEGTTEIGCFV---ENC-----PTFTYSVCQYGPAGNYMNQLIYTKGSPCTADADCPGTQT 413

  Fly   253 KEFAN-LC 259
            ...|. ||
 Worm   414 CSVAEALC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/164 (22%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553
SCP 234..386 CDD:214553 38/166 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.