Sequence 1: | NP_001261162.1 | Gene: | CG43776 / 14462630 | FlyBaseID: | FBgn0264298 | Length: | 270 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001024553.1 | Gene: | vap-1 / 181768 | WormBaseID: | WBGene00006886 | Length: | 424 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 47/203 - (23%) |
---|---|---|---|
Similarity: | 86/203 - (42%) | Gaps: | 31/203 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 KLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRS 126
Fly 127 TVRFPRVGECLAMM----VPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHF 187
Fly 188 TIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKS 252
Fly 253 KEFAN-LC 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43776 | NP_001261162.1 | SCP_euk | 64..225 | CDD:240180 | 36/164 (22%) |
vap-1 | NP_001024553.1 | SCP | 31..175 | CDD:214553 | |
SCP | 234..386 | CDD:214553 | 38/166 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X35 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.020 |