DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and scl-13

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:204 Identity:43/204 - (21%)
Similarity:79/204 - (38%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRF 130
            :|:...|..|:..|.|::..:..:. ..|..||:|:||..:|..|:.:|......|:.       
 Worm    25 QIVDAHNKLRSAIAQGSYVAAGTQE-PSASNMRKIVWDETVAAAAQEYAEGCPDDHSG------- 81

  Fly   131 PRVGECL----AMMVPKYKHTVHEALKKMFKIMFDEH---LHIQDPRGLLQGFHPIRDYVSSHFT 188
            ...||.|    :...|........|....::..|.::   ....|..|...|.        .|.|
 Worm    82 TSYGENLYWSWSSSAPSSLDKFGVAASNSWESEFQKYGWTSTFLDEAGFATGI--------GHAT 138

  Fly   189 IIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYD---NVNGSYVYKAGKPASSCSDWGTT 250
            .:.....|::|||:   .||.:.::....:.:.....||   |:..|.:|:.|:..|:||:  ..
 Worm   139 QMAWAETSKIGCGI---KNCGKDANKKNMYKVAVVCQYDSAGNMMDSDIYQQGETCSACSE--DA 198

  Fly   251 KSKEFANLC 259
            ..::.:.||
 Worm   199 SCEQDSGLC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 32/165 (19%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 32/167 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.