DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and lon-1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:223 Identity:52/223 - (23%)
Similarity:78/223 - (34%) Gaps:69/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QFASGAFRTSEN----------------RTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCR 125
            |..||....||:                |....|..|..:.|..|||..|:.||.|..|:|::.|
 Worm    64 QSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTCDFRHSRGR 128

  Fly   126 STVRFPRVGECL-AMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTI 189
            .     .|||.: |.....|...:        .|.|:|   :.:||   .|.:....:...|:..
 Worm   129 I-----NVGENIWAAPYSNYSDAI--------SIWFNE---VHNPR---CGCNHAYKHCCGHYVQ 174

  Fly   190 IVSDRVSRVGCGVAVGTNCR-------QGSSSNF-CHFLTCYFDYDNVNGSYVYKAGK------P 240
            :|..:.:.||||.   :.||       :|..:.| ||:        |..|:.|:...:      |
 Worm   175 VVWAKTNLVGCGF---SRCRDVQGVWGRGHRNVFVCHY--------NPQGNTVFVTARGQLYAMP 228

  Fly   241 A--------SSCSDWGTTKSKEFANLCY 260
            |        ..||:........:..|||
 Worm   229 AFTWASGDNGKCSNCPANAPACYQGLCY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 42/172 (24%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 37/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.