DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crispld2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:222 Identity:51/222 - (22%)
Similarity:76/222 - (34%) Gaps:67/222 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTV 128
            |.|||.:.|..|.|            .:..|..|..:.||.||...|.:.|....::|......|
  Rat    56 RQEILMLHNKLRGQ------------VYPPASNMEYMTWDEELERSAAAWAQRCLWEHGPASLLV 108

  Fly   129 RFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY----------- 182
               .:|:.||:...:|:               ....|:|      ..:..::||           
  Rat   109 ---SIGQNLAVHWGRYR---------------SPGFHVQ------SWYDEVKDYTYPYPHECNPW 149

  Fly   183 --------VSSHFTIIVSDRVSRVGCGVAVGTNCRQ----GSSSNFCHFLTC-YFDYDNVNGSYV 234
                    :.:|:|.:|....:::||.|   ..||.    |.......:|.| |....|..|...
  Rat   150 CPERCSGAMCTHYTQMVWATTNKIGCAV---HTCRSMSVWGDIWENAVYLVCNYSPKGNWIGEAP 211

  Fly   235 YKAGKPASSC-SDWGTTKSKEFANLCY 260
            ||.|:|.|.| |.:|.....   ||||
  Rat   212 YKHGRPCSECPSSYGGGCRN---NLCY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 37/184 (20%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 36/183 (20%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344694
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.