DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CRISP1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:242 Identity:50/242 - (20%)
Similarity:77/242 - (31%) Gaps:93/242 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RYHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHAST 116
            :::.:|.|:|.::.||:.|.|..|            .|....|..|.::.|..|.|..||..:. 
Human    29 QFNKLVTDLPNVQEEIVNIHNALR------------RRVVPPASNMLKMSWSEEAAQNARIFSK- 80

  Fly   117 VSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIR- 180
                  .|..|...|     |...:|              .....|::|:..        :|:. 
Human    81 ------YCDMTESNP-----LERRLP--------------NTFCGENMHMTS--------YPVSW 112

  Fly   181 ------------------------DYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF---CH 218
                                    |..:.|:|.||......:||.:|   :|||..|..:   ||
Human   113 SSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIA---SCRQQGSPRYLYVCH 174

  Fly   219 FLTCYFDYDNVNGSYVYKAGKPA----SSCSDWGTTKSKEFANLCYN 261
            :  |:...|....:..||.|.|.    |:|.|          .||.|
Human   175 Y--CHEGNDPETKNEPYKTGVPCEACPSNCED----------KLCTN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/188 (19%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 35/188 (19%)
Crisp 195..249 CDD:285731 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.