DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and GLIPR2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:173 Identity:38/173 - (21%)
Similarity:65/173 - (37%) Gaps:38/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PDIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHT 122
            |...:...|:|:..|.:|.:......:..:|.. .:|::..:.|            |||...:|:
Human    19 PASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLN-REAQQYSEAL------------ASTRILKHS 70

  Fly   123 KCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHF 187
            ...|.   .:.||.||.  ..|..|..|...:.:..:  ::.:.|.| |...|        :.||
Human    71 PESSR---GQCGENLAW--ASYDQTGKEVADRWYSEI--KNYNFQQP-GFTSG--------TGHF 119

  Fly   188 TIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTC-YFDYDNV 229
            |.:|.....::|.|.|        |:|:...|:.. ||...||
Human   120 TAMVWKNTKKMGVGKA--------SASDGSSFVVARYFPAGNV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 34/161 (21%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.