DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:230 Identity:51/230 - (22%)
Similarity:79/230 - (34%) Gaps:56/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGGTRYHAIVPDIPKLRTEILRIIN---NFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYM 109
            ||.:.....:||     .|.:..||   |..|:..........|        :|.:.||..|:..
Human    36 LGSSLNARFLPD-----EEDVDFINEYVNLHNELRGDVIPRGSN--------LRFMTWDVALSRT 87

  Fly   110 ARSHASTVSFQHTKCRSTV-----RFPRVGECLAMMVPKYKHTVHEAL------KKMFKIMFDEH 163
            ||:......|.|......|     :|..:||.: .:.|:.:.|...|:      |||:..     
Human    88 ARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENM-WVGPENEFTASIAIRSWHAEKKMYNF----- 146

  Fly   164 LHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQ-GSSSNFCHFLTCYFDYD 227
                 ..|...|       ..|::..:|.|...:|||.|   |.|.: |...:...|:..|..  
Human   147 -----ENGSCSG-------DCSNYIQLVWDHSYKVGCAV---TPCSKIGHIIHAAIFICNYAP-- 194

  Fly   228 NVNGSYVYKAGKPASSCSDWG-TTKSKEFANLCYN 261
              .|:...:..:|...|:..| ..|..:|  ||.|
Human   195 --GGTLTRRPYEPGIFCTRCGRRDKCTDF--LCSN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 38/175 (22%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 37/175 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.