DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crisp1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:149 Identity:38/149 - (25%)
Similarity:58/149 - (38%) Gaps:22/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 WDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHI 166
            |:.:....|:..|...:|.|:.........|.||.|.|  ..|..:...|::.    .::|:..:
Mouse    65 WNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFM--SSYLASWSSAIQG----WYNEYKDL 123

  Fly   167 QDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF--CHFLTCYFDYDNV 229
            ....|..|     .|.|..|:|.:|.:...:|.||||   .|.:.....:  ||    |....|.
Mouse   124 TYDVGPKQ-----PDSVVGHYTQVVWNSTFQVACGVA---ECPKNPLRYYYVCH----YCPVGNY 176

  Fly   230 NGSYV--YKAGKPASSCSD 246
            .|...  |.||:|.:||.|
Mouse   177 QGRLYTPYTAGEPCASCPD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 29/124 (23%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 29/124 (23%)
Crisp 190..244 CDD:285731 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.