DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and glipr1a

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:200 Identity:52/200 - (26%)
Similarity:75/200 - (37%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SENRTFTQ--AKRMRQILWDSELAYMARSHASTVSFQHT-KCRSTVR----FPRVGECLAMMVPK 143
            ::||:...  |..||.:.||:.||..||:.|....|:|. ..|...|    |..|||.:....|.
Zfish    40 NQNRSSVSPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPY 104

  Fly   144 YKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY-----------VSSHFTIIVSDRVSR 197
            .:.||..|                    :....:.::||           |..|:|.:|.....:
Zfish   105 SRFTVKSA--------------------VFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYK 149

  Fly   198 VGCGVAVGTNCRQG-SSSNFCH-----FLTCYFDYDNVNGSYVYKAGKPASSCSDWGTTKSKEFA 256
            |||.|   ..|..| :.::|.:     |:..|....|..|...||.|...|.|.  |:.|.:.  
Zfish   150 VGCAV---QTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCG--GSDKCER-- 207

  Fly   257 NLCYN 261
            |||.|
Zfish   208 NLCRN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 39/162 (24%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.