DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CG42780

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:272 Identity:63/272 - (23%)
Similarity:116/272 - (42%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPD--IPKL----RTEIL 68
            :|.:...:...|:|  |...| ...|.|..|:     ::.|:...:...|  :.||    :..::
  Fly    10 VLSLVLHSLAENFC--RQDLC-TKGTTHIACQ-----NVNGSFGSSCPKDATVIKLNLGDKNALI 66

  Fly    69 RIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRV 133
            :..|..|.::|||..:..    :|..| |.::.|:.:|..:|..:|.|....|.:|.:|.:|...
  Fly    67 KAHNLVRQKWASGKAKIK----WTACK-MAKMEWNKDLEKLAILNAKTCLMGHDECHNTEKFRLS 126

  Fly   134 GECLAMM------VPKYKHTVHEALKKMFKIMF------DEHLHIQDPRGLLQGFHPIRDYVSSH 186
            |:.|..|      :.|.|  ::..|..:|::..      ::.:..:|    |:...|....|..|
  Fly   127 GQNLFAMGFSHARITKTK--MNMTLSMLFEMAVQKWAGEEKDITAED----LKKTTPNPPEVIGH 185

  Fly   187 FTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSYVY----KAGKPASSCSDW 247
            .|::::::.:.||||: |..|..:....|    |.|.:.|.||.|..||    |||...:...| 
  Fly   186 LTVLINEKSNAVGCGL-VAYNLGEIRRYN----LACNYAYTNVIGERVYEECAKAGIECAKGID- 244

  Fly   248 GTTKSKEFANLC 259
                 :::..||
  Fly   245 -----QKYPPLC 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 39/172 (23%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440682
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.