DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and r3hdml

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:237 Identity:59/237 - (24%)
Similarity:93/237 - (39%) Gaps:66/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TEILRIINNFRNQ----FASGAFRTSENR--------------------TFTQAKRMRQILWDSE 105
            ||:|.:.|  |||    |.||..|....|                    .|..|..|..::||..
 Frog    30 TELLSLSN--RNQTEHMFGSGIPRIRRKRYISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDER 92

  Fly   106 LAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPR 170
            ||..|.|.|:...:.|.. ...:|:  :|:.|::...:|:..|     .:.|..:||..|...| 
 Frog    93 LAKSAESWANQCKWDHGP-NQLMRY--IGQNLSVHSGRYRSIV-----DLVKGWYDERQHYSFP- 148

  Fly   171 GLLQGFHP----------IRDYVSSHFTIIVSDRVSRVGCGVAVGTNCR-QGSSSNFCHFLTCYF 224
                  ||          ....|.:|:|.:|....:|:||.|.:.||.. .||:.....:|.|.:
 Frog   149 ------HPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNY 207

  Fly   225 DYDNVNGSYV----YKAGKPASSCSDWGTTKSKEFANLCYNN 262
               ::.|:::    ||.|:|.|:|       ...:..:|.||
 Frog   208 ---SIKGNWIGEAPYKLGRPCSAC-------PPSYGGVCSNN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 49/194 (25%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.