DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and crisp1.11

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:202 Identity:48/202 - (23%)
Similarity:82/202 - (40%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HAIV---PDIPKLRTE---ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARS 112
            ||:.   |....:.|:   :.:||.:..|.:...|..::.|        |.:::|:.:.|..|.|
 Frog    40 HAVASADPPFSSISTDNSTVRQIIIDTHNAYRRNASPSARN--------MLKMVWNEDAANNAAS 96

  Fly   113 HASTVSFQHT-KCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGF 176
            .::..:..|: ..:.|:.....||.|  .:..|..:..||:    |..|||:...:      .|.
 Frog    97 WSAGCTGSHSPPDKRTIPGFSCGENL--FLASYPASWEEAV----KAWFDENESFE------YGV 149

  Fly   177 HP-IRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTC-YFDYDNVNG--SYVYKA 237
            .| ..|.|..|:|.::......|||.|:.   |   ..|.:.:|..| |....|:.|  :..|||
 Frog   150 GPKSPDQVVGHYTQVMWYNSYMVGCSVSY---C---PKSQYKYFYVCQYCPAGNIEGVMNTPYKA 208

  Fly   238 GKPASSC 244
            |...:.|
 Frog   209 GPKCADC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 38/166 (23%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 37/162 (23%)
Crisp 212..263 CDD:400739 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.