DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and LOC100490275

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:326 Identity:70/326 - (21%)
Similarity:107/326 - (32%) Gaps:132/326 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPDIPKLRTEILRII 71
            ||.::::.::      |..|              :||..|:....|:          .|:::...
 Frog     3 LPQLMLVVSV------CGAR--------------QLDPTPAYNNERF----------VTDLVNAH 37

  Fly    72 NNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARS---HASTVSFQHTKCRSTV-RFPR 132
            |:.||:|..            ||..|..:.||..||.:|::   :...|...|....|.. ||.:
 Frog    38 NDIRNEFGK------------QAANMLHMSWDVGLAKLAQAWTINCKKVPNPHLNKESIYPRFKQ 90

  Fly   133 VGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYV------SSHFTIIV 191
            :||.| .|.|..         .:|||:.:        .||...|:.:::..      .||||.||
 Frog    91 IGENL-YMGPSI---------DIFKIVTN--------WGLEGNFYDLKNNSCQPGKDCSHFTQIV 137

  Fly   192 SDRVSRVGCG-------VAVGTNCRQGSSSNF-------------------CHFLTC-------- 222
            .....:||||       ||...:|..|...|.                   |:..:|        
 Frog   138 WANTYKVGCGAAYCAHKVAYVVSCTYGPRGNLLGQVPFILGVKCSKCGGEKCNVASCGNPSRDEN 202

  Fly   223 YFDYD------------------NVNGSYVYKAGKPASSC------SDWGTTKSKEFANLCYNNG 263
            |.||:                  .||...| :.|...:.|      |:.||  ...||.:.| .|
 Frog   203 YGDYNYCPPFATIDCYRLSKGNVRVNNEKV-RVGLECADCVYTDGDSESGT--EDHFAYVDY-TG 263

  Fly   264 N 264
            |
 Frog   264 N 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 47/204 (23%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 44/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.